PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009625011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 224aa    MW: 26249.3 Da    PI: 6.2489
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009625011.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.3e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEde+l+ +++ lG ++W++ a+  g++R++k+c++rw +yl
   XP_009625011.1 16 KGPWLEEEDERLASVIAILGERRWDALAKASGLRRSGKSCRLRWMNYL 63
                     79********************************************97 PP

2Myb_DNA-binding48.22.5e-1572114448
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       T++E+ l+v++ kq+G++ W++I + ++ gRt++++k++w+++l
   XP_009625011.1  72 ITEDEERLIVQLQKQFGNK-WSKIVKQLP-GRTDNEIKNYWRSHL 114
                      59*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.2871163IPR017930Myb domain
SuperFamilySSF466896.6E-2714110IPR009057Homeodomain-like
SMARTSM007175.9E-131565IPR001005SANT/Myb domain
PfamPF002492.1E-141663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-201770IPR009057Homeodomain-like
CDDcd001671.57E-81863No hitNo description
PROSITE profilePS5129425.44664118IPR017930Myb domain
SMARTSM007179.5E-1568116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2371117IPR009057Homeodomain-like
PfamPF002493.0E-1372114IPR001005SANT/Myb domain
CDDcd001679.08E-1173114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MAFQLQLTMQ EEKLRKGPWL EEEDERLASV IAILGERRWD ALAKASGLRR SGKSCRLRWM  60
NYLRPNLKHG HITEDEERLI VQLQKQFGNK WSKIVKQLPG RTDNEIKNYW RSHLRKKTMI  120
YEQDCSGSNT STNSELKSSF GKDDCSSADS LTEMEVSNYS IDHSSNETRL SDWIPSWTYE  180
QSQMEHHMYL CRLNICSCYP QCFSEDNNSS ISTWDDTSSS IWEQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-28141182105MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-271411856159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-271411856159MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-28141182105C-Myb DNA-Binding Domain
1msf_C3e-28141182105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00406DAPTransfer from AT3G53200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754481e-38HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755211e-38HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009625011.11e-167PREDICTED: transcription factor MYB48-like
TrEMBLK4D3H62e-93K4D3H6_SOLLC; Uncharacterized protein
STRINGSolyc10g083900.1.15e-93(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.15e-55myb domain protein 27